Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX4 Peptide - middle region

SNX4 Peptide - middle region

Product Specifications

Product Name Alternative

ATG24B

UniProt

O95219

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX4 Rabbit Polyclonal Antibody (orb588362) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003785.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FRVKNPDKRFTDLKHYSDELQSVISHLLRVRARVADRLYGVYKVHGNYGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multimerin-1 Rabbit Polyclonal Antibody
orb667303-01 30 µL

Multimerin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Multimerin-1 Rabbit Polyclonal Antibody
orb667303-02 50 μL

Multimerin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Multimerin-1 Rabbit Polyclonal Antibody
orb667303-03 100 µL

Multimerin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Multimerin-1 Rabbit Polyclonal Antibody
orb667303-04 200 µL

Multimerin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPT2 Rabbit Polyclonal Antibody
MBS9514038-01 0.05 mL

CPT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CPT2 Rabbit Polyclonal Antibody
MBS9514038-02 0.1 mL

CPT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details