TAF5L Peptide - middle region
TAF5L Peptide - middle region
Product Specifications
Product Name Alternative
PAF65B
UniProt
O75529
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAF5L Rabbit Polyclonal Antibody (orb588369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001020418.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALE
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal SENP2 Antibody (OTI3D3) [DyLight 488]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
NBP2-74062G 0.1 mL
Mouse Monoclonal SENP2 Antibody (OTI3D3) [DyLight 488]
Sign In for Pricing
View Details 
GTR15327777 1 Vial
Lentiviral human TPRX1 shRNA (UAS) - Lentiviral human TPRX1 shRNA (UAS) (100)
Sign In for Pricing
View Details YP-W31840-01 48 Tests
Rat gonadotropin-releasing hormone antibody (GnRH Ab) ELISA Kit
Sign In for Pricing
View Details YP-W31840-02 96 Tests
Rat gonadotropin-releasing hormone antibody (GnRH Ab) ELISA Kit
Sign In for Pricing
View Details