TAF5L Peptide - middle region
TAF5L Peptide - middle region
Product Specifications
Product Name Alternative
PAF65B
UniProt
O75529
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TAF5L Rabbit Polyclonal Antibody (orb588369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001020418.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALE
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9356922-01 48 Well
Sheep Ribose-Phosphate Pyrophosphokinase 1 (PRPS1) ELISA Kit
Sign In for Pricing
View Details MBS9356922-02 96 Well
Sheep Ribose-Phosphate Pyrophosphokinase 1 (PRPS1) ELISA Kit
Sign In for Pricing
View Details MBS9356922-03 5x 96 Well
Sheep Ribose-Phosphate Pyrophosphokinase 1 (PRPS1) ELISA Kit
Sign In for Pricing
View Details MBS9356922-04 10x 96 Well
Sheep Ribose-Phosphate Pyrophosphokinase 1 (PRPS1) ELISA Kit
Sign In for Pricing
View Details 
abx529433 96 Tests
Human Kelch repeat and BTB domain-containing protein 11 (KBTBD11) ELISA Kit
Sign In for Pricing
View Details