Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA2 Peptide - N-terminal region

EPHA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ECK, CTPA, ARCC2, CTPP1, CTRCT6

UniProt

P29317

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHA2 Rabbit Polyclonal Antibody (orb588918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004422.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IL-1α (Interleukin 1 Alpha) CLIA Kit
E-CL-M0034-01 24 Tests

Mouse IL-1α (Interleukin 1 Alpha) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-1α (Interleukin 1 Alpha) CLIA Kit
E-CL-M0034-02 48 Tests

Mouse IL-1α (Interleukin 1 Alpha) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-1α (Interleukin 1 Alpha) CLIA Kit
E-CL-M0034-03 96 Tests

Mouse IL-1α (Interleukin 1 Alpha) CLIA Kit

Sign In for Pricing
View Details
CD300LB Antibody
KC-28084-01 50 μL

CD300LB Antibody

Sign In for Pricing
View Details
CD300LB Antibody
KC-28084-02 100 µL

CD300LB Antibody

Sign In for Pricing
View Details
CD300LB Antibody
KC-28084-03 1 mL

CD300LB Antibody

Sign In for Pricing
View Details