Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHA2 Peptide - N-terminal region

EPHA2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ECK, CTPA, ARCC2, CTPP1, CTRCT6

UniProt

P29317

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHA2 Rabbit Polyclonal Antibody (orb588918) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004422.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYMYSVCNVMSGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VCAN Antibody
8C19494-AAT 50 µg

VCAN Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase (ALPL) (NM_000478) Human Over-expression Lysate
LY400165 100 µg

Alkaline Phosphatase (ALPL) (NM_000478) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-2019-nCoV Spike Neutralizing Antibody
E-AB-V1025-01 20 µL

Anti-2019-nCoV Spike Neutralizing Antibody

Sign In for Pricing
View Details
Anti-2019-nCoV Spike Neutralizing Antibody
E-AB-V1025-02 100 µL

Anti-2019-nCoV Spike Neutralizing Antibody

Sign In for Pricing
View Details
Ninein (NIN) Human Gene Knockout Kit (CRISPR)
KN415020 1 Kit

Ninein (NIN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NGFR (Nerve Growth Factor Receptor) (NGFR5), CF640R conjugate, 0.1mg/mL
BNC400890-500 1x 500 µL

NGFR (Nerve Growth Factor Receptor) (NGFR5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details