Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB2 Peptide - C-terminal region

EPHB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DRT, EK5, ERK, CAPB, Hek5, PCBC, EPHT3, Tyro5

UniProt

P29323

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHB2 Rabbit Polyclonal Antibody (orb588920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004433.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Polyclonal Goat anti-Rat IgG2a/IgG2b Secondary Antibody [HRP] (Azide Free)
NBP2-69590 1 mL

Goat Polyclonal Goat anti-Rat IgG2a/IgG2b Secondary Antibody [HRP] (Azide Free)

Sign In for Pricing
View Details
P53 K320 Rabbit Polyclonal Antibody
E53P01437 100 µL

P53 K320 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse GM527 Protein, His (Fc)-Avi-tagged
GM527-3714M 50 µg

Recombinant Mouse GM527 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CD43 (SPN) Mouse Monoclonal Antibody [Clone:6A4]
E45M14814 100 µg

CD43 (SPN) Mouse Monoclonal Antibody [Clone:6A4]

Sign In for Pricing
View Details
SPTLC1 Antibody
CSB-PA910014-01 50 μL

SPTLC1 Antibody

Sign In for Pricing
View Details
SPTLC1 Antibody
CSB-PA910014-02 100 µL

SPTLC1 Antibody

Sign In for Pricing
View Details