Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHB2 Peptide - C-terminal region

EPHB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DRT, EK5, ERK, CAPB, Hek5, PCBC, EPHT3, Tyro5

UniProt

P29323

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHB2 Rabbit Polyclonal Antibody (orb588920) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004433.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PRATGRTKRCQPRDVTKKTCNSNDGKKKGMGKKKTDPGRGREIQGIFFKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNRPD2P AAV siRNA Pooled Vector
67609161 1.0 µg

SNRPD2P AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Setsip (NM_194353) Rat Tagged ORF Clone Lentiviral Particle
RR213325L3V 200 µL

Setsip (NM_194353) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
4- (3-Chloro-2-thienyl) -2-pyrimidinamine
sc-310908A 5 mg

4- (3-Chloro-2-thienyl) -2-pyrimidinamine

Sign In for Pricing
View Details
ZNF509-set siRNA/shRNA/RNAi Lentivector (Human)
51572091 4x 500 ng

ZNF509-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
UPK3B Monoclonal Antibody
BT-MCA3765-01 50 µL

UPK3B Monoclonal Antibody

Sign In for Pricing
View Details
UPK3B Monoclonal Antibody
BT-MCA3765-02 100 µL

UPK3B Monoclonal Antibody

Sign In for Pricing
View Details