Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL11 Peptide - N-terminal region

NOL11 Peptide - N-terminal region

Product Specifications

UniProt

Q9H8H0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOL11 Rabbit Polyclonal Antibody (orb588945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001290201.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal MUC1 Antibody (Mc5)
NBP3-21450-0.1mg 0.1 mg

Mouse Monoclonal MUC1 Antibody (Mc5)

Sign In for Pricing
View Details
Mouse Interleukin 1 Receptor Antagonist (IL1RA), Active Protein
RPU54884-01 50 µg

Mouse Interleukin 1 Receptor Antagonist (IL1RA), Active Protein

Sign In for Pricing
View Details
Mouse Interleukin 1 Receptor Antagonist (IL1RA), Active Protein
RPU54884-02 100 µg

Mouse Interleukin 1 Receptor Antagonist (IL1RA), Active Protein

Sign In for Pricing
View Details
Mouse Interleukin 1 Receptor Antagonist (IL1RA), Active Protein
RPU54884-03 1 mg

Mouse Interleukin 1 Receptor Antagonist (IL1RA), Active Protein

Sign In for Pricing
View Details
KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (MaxLight 750) discontinued
247922-ML750 100 µL

KIT (v-kit Hardy-Zuckerman 4 feline Sarcoma Viral Oncogene Homolog, C-Kit, CD117, PBT, SCFR) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal Collectrin/TMEM27 Antibody [Janelia Fluor 635]
NBP3-30745JF635 0.1 mL

Rabbit Polyclonal Collectrin/TMEM27 Antibody [Janelia Fluor 635]

Sign In for Pricing
View Details