Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOL11 Peptide - N-terminal region

NOL11 Peptide - N-terminal region

Product Specifications

UniProt

Q9H8H0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOL11 Rabbit Polyclonal Antibody (orb588945) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001290201.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSGRTVILYKVSDQKPLGSWSVKQGQIITCPAVCNFQTGEYVVVHDNKVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NADH ubiquinone oxidoreductase chain 4L (MT ND4L) ELISA kit
GTR10468501 96 Well

Mouse NADH ubiquinone oxidoreductase chain 4L (MT ND4L) ELISA kit

Sign In for Pricing
View Details
FIMA Recombinant Protein (Escherichia coli)
OPCA04588-100UG 100 µg

FIMA Recombinant Protein (Escherichia coli)

Sign In for Pricing
View Details
Histone Deacetylase 4 Antibody
MBS8503525-01 0.1 mg

Histone Deacetylase 4 Antibody

Sign In for Pricing
View Details
Histone Deacetylase 4 Antibody
MBS8503525-02 0.1 mL (AF405L)

Histone Deacetylase 4 Antibody

Sign In for Pricing
View Details
Histone Deacetylase 4 Antibody
MBS8503525-03 0.1 mL (AF405S)

Histone Deacetylase 4 Antibody

Sign In for Pricing
View Details
Histone Deacetylase 4 Antibody
MBS8503525-04 0.1 mL (AF610)

Histone Deacetylase 4 Antibody

Sign In for Pricing
View Details