Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP11 Peptide - middle region

USP11 Peptide - middle region

Product Specifications

Product Name Alternative

UHX1

UniProt

P51784

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with USP11 Rabbit Polyclonal Antibody (orb589067) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004642.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCV

More Discoveries

Explore Other Products

Browse additional items from our catalog

pBluescriptR-LOC102725072 Plasmid

PVT23334 2 µg

pBluescriptR-LOC102725072 Plasmid

Sign In for Pricing

Mir378 Mouse qPCR Primer Pair (MI0000795)

MP300294 200 Reactions

Mir378 Mouse qPCR Primer Pair (MI0000795)

Sign In for Pricing

Lafutidine 100mg

A11714-100 100 mg

Lafutidine 100mg

Sign In for Pricing

PARP6, CT (Poly [ADP-ribose] Polymerase 6, PARP-6) (MaxLight 750)

MBS6492179-01 0.1 mL

PARP6, CT (Poly [ADP-ribose] Polymerase 6, PARP-6) (MaxLight 750)

Sign In for Pricing

PARP6, CT (Poly [ADP-ribose] Polymerase 6, PARP-6) (MaxLight 750)

MBS6492179-02 5x 0.1 mL

PARP6, CT (Poly [ADP-ribose] Polymerase 6, PARP-6) (MaxLight 750)

Sign In for Pricing

3-O-β-D-Galactopyranosyl-β-L-arabinopyranose

sc-489533 10 mg

3-O-β-D-Galactopyranosyl-β-L-arabinopyranose

Sign In for Pricing