Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YME1L1 Peptide - middle region

YME1L1 Peptide - middle region

Product Specifications

Product Name Alternative

FTSH, MEG4, PAMP, YME1L

UniProt

Q96TA2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with YME1L1 Rabbit Polyclonal Antibody (orb589112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001240795.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REM2 Protein Vector (Mouse) (pPB-C-His)
PV223454 500 ng

REM2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
LMX1B Protein Vector (Human) (pPM-C-HA)
PV023907 500 ng

LMX1B Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CA196 rabbit pAb Antibody
orb2305978-01 50 µL

CA196 rabbit pAb Antibody

Sign In for Pricing
View Details
CA196 rabbit pAb Antibody
orb2305978-02 100 µL

CA196 rabbit pAb Antibody

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD223 (LAG-3)
GT15020 25 Tests

Alexa Fluor® 647 anti-human CD223 (LAG-3)

Sign In for Pricing
View Details
DNAH9 Rabbit pAb
E47R11210 100 µL

DNAH9 Rabbit pAb

Sign In for Pricing
View Details