YME1L1 Peptide - middle region
YME1L1 Peptide - middle region
Product Specifications
Product Name Alternative
FTSH, MEG4, PAMP, YME1L
UniProt
Q96TA2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YME1L1 Rabbit Polyclonal Antibody (orb589112) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001240795.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1286809-01 0.02 mg (E-Coli)
Recombinant Escherichia coli Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1286809-02 0.1 mg (E-Coli)
Recombinant Escherichia coli Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1286809-03 0.02 mg (Yeast)
Recombinant Escherichia coli Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1286809-04 0.1 mg (Yeast)
Recombinant Escherichia coli Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1286809-05 0.02 mg (Baculovirus)
Recombinant Escherichia coli Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details MBS1286809-06 0.02 mg (Mammalian-Cell)
Recombinant Escherichia coli Lipoprotein-releasing system ATP-binding protein LolD (lolD)
Sign In for Pricing
View Details