UNC5CL Peptide - C-terminal region
UNC5CL Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZUD, MUXA
UniProt
Q04206
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UNC5CL Rabbit Polyclonal Antibody (orb589115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775832.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEQNGSLQELHYLMTVMERLDCASAIQNYLSGTHGGSPGPERGGARDNQG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6337970-01 0.1 mL
PRSS7, CT (E979) (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine protease 7, Transmembrane protease serine 15, Enteropeptidase non-catalytic heavy chain, Enteropeptidase catalytic light chain) (MaxLight 550)
Sign In for Pricing
View Details MBS6337970-02 5x 0.1 mL
PRSS7, CT (E979) (TMPRSS15, ENTK, PRSS7, Enteropeptidase, Enterokinase, Serine protease 7, Transmembrane protease serine 15, Enteropeptidase non-catalytic heavy chain, Enteropeptidase catalytic light chain) (MaxLight 550)
Sign In for Pricing
View Details BAC00600-01 50 mg
2-[ (tert-butoxy) carbonyl]-5-oxa-2-azaspiro[3.4]octane-6-carboxylic acid
Sign In for Pricing
View Details