UNC5CL Peptide - C-terminal region
UNC5CL Peptide - C-terminal region
Product Specifications
Product Name Alternative
ZUD, MUXA
UniProt
Q04206
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with UNC5CL Rabbit Polyclonal Antibody (orb589115) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775832.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEQNGSLQELHYLMTVMERLDCASAIQNYLSGTHGGSPGPERGGARDNQG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
324612-01 50 µL
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-Associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-Associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM)
Sign In for Pricing
View Details 324612-02 100 µL
MUC1 (Mucin-1, MUC-1, Breast Carcinoma-Associated Antigen DF3, Cancer Antigen 15-3, CA 15-3, Carcinoma-Associated Mucin, Episialin, H23AG, Krebs von den Lungen-6, KL-6, PEMT, Peanut-reactive Urinary Mucin, PUM, Polymorphic Epithelial Mucin, PEM)
Sign In for Pricing
View Details 