Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF622 Peptide - N-terminal region

ZNF622 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZPR9

UniProt

Q969S3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF622 Rabbit Polyclonal Antibody (orb589122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-butyryl-L-Homocysteine thiolactone
MBS5798267 Inquire

N-butyryl-L-Homocysteine thiolactone

Sign In for Pricing
View Details
AMZ1 (Archaemetzincin-1, 34--, Archeobacterial Metalloproteinase-like Protein 1, AMZ1, KIAA1950) (MaxLight 490) discontinued
302262-ML490 100 µL

AMZ1 (Archaemetzincin-1, 34--, Archeobacterial Metalloproteinase-like Protein 1, AMZ1, KIAA1950) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ZC3HAV1L CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
50752154 3x 1.0 µg DNA

ZC3HAV1L CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Hepatitis B Surface Antigen (HBsAg) (APC) discontinued
H1910-APC 100 µL

Hepatitis B Surface Antigen (HBsAg) (APC) discontinued

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 2 Receptor Gamma (IL2Rg)
MBS2169398-01 0.1 mL

Monoclonal Antibody to Interleukin 2 Receptor Gamma (IL2Rg)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 2 Receptor Gamma (IL2Rg)
MBS2169398-02 0.2 mL

Monoclonal Antibody to Interleukin 2 Receptor Gamma (IL2Rg)

Sign In for Pricing
View Details