Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF622 Peptide - N-terminal region

ZNF622 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZPR9

UniProt

Q969S3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF622 Rabbit Polyclonal Antibody (orb589122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219482.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEEESKG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lrrc30 shRNA (UAS) - Lentiviral mouse Lrrc30 shRNA (UAS, iRFP) plasmid
GTR15241840 1 Vial

Lentiviral mouse Lrrc30 shRNA (UAS) - Lentiviral mouse Lrrc30 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Anti-C. Elegans UNC-70 Antibody (Dylight488 Conjugate)
DZ33971-Dylight488 200 µL

Anti-C. Elegans UNC-70 Antibody (Dylight488 Conjugate)

Sign In for Pricing
View Details
Rat Secretogranin-2 (SCG2) ELISA Kit
AE20598RA-01 48 Tests

Rat Secretogranin-2 (SCG2) ELISA Kit

Sign In for Pricing
View Details
Rat Secretogranin-2 (SCG2) ELISA Kit
AE20598RA-02 96 Tests

Rat Secretogranin-2 (SCG2) ELISA Kit

Sign In for Pricing
View Details
WDR38 CRISPR Activation Plasmid (h)
sc-415981-ACT 20 µg

WDR38 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
MAP7 Protein Vector (Rat) (pPM-C-His)
PV281045 500 ng

MAP7 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details