Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP7 Peptide - middle region

FKBP7 Peptide - middle region

Product Specifications

Product Name Alternative

FKBP23, PPIase

UniProt

Q9Y680

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FKBP7 Rabbit Polyclonal Antibody (orb589125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001128684.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OIP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B1]
TA810643BM 100 µL

OIP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4B1]

Sign In for Pricing
View Details
GC1q R (C1QBP) Mouse Monoclonal Antibody [Clone ID: AT1G7]
AM50354PU-S 50 µL

GC1q R (C1QBP) Mouse Monoclonal Antibody [Clone ID: AT1G7]

Sign In for Pricing
View Details
TC 2559 Fumarate
TRC-T012005-2.5MG 2.5 mg

TC 2559 Fumarate

Sign In for Pricing
View Details
2,2,4,4,6,6-Hexakis[(2,2,3,3,4,4,5,5-octafluoropentyl)oxy]-2Lambda5,4Lambda5,6Lambda5-1,3,5,2,4,6-triazatriphosphorine
TRC-H293970-5MG 5 mg

2,2,4,4,6,6-Hexakis[(2,2,3,3,4,4,5,5-octafluoropentyl)oxy]-2Lambda5,4Lambda5,6Lambda5-1,3,5,2,4,6-triazatriphosphorine

Sign In for Pricing
View Details
1,1'-Ferrocenedicarboxylic Acid
TRC-F307620-500MG 500 mg

1,1'-Ferrocenedicarboxylic Acid

Sign In for Pricing
View Details
Cycloxygenase-2 (COX-2) (COX2/1941), CF594 conjugate, 0.1mg/mL
BNC942377-500 1x 500 µL

Cycloxygenase-2 (COX-2) (COX2/1941), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details