FKBP7 Peptide - middle region
FKBP7 Peptide - middle region
Product Specifications
Product Name Alternative
FKBP23, PPIase
UniProt
Q9Y680
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FKBP7 Rabbit Polyclonal Antibody (orb589125) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001128684.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FTAQRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD82 Recombinant Rabbit Monoclonal Antibody [JE32-17]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea81349/imageurl/ha722533.webp)
HA722533 100 µL
CD82 Recombinant Rabbit Monoclonal Antibody [JE32-17]
Sign In for Pricing
View Details 
BNC742885-100 1x 100 µL
CD81 / TAPA-1 (C81/2885R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942041-100 1x 100 µL
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 