Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IP6K3 Peptide - C-terminal region

IP6K3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IHPK3, INSP6K3

UniProt

Q96PC2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IP6K3 Rabbit Polyclonal Antibody (orb589292) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001136355.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPGGLTKVDIRMIDFAHTTYKGYWNEHTTYDGPDPGYIFGLENLIRILQD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Protein Kinase C Zeta (PKCz) ELISA Kit
MBS453830-01 48 Tests

Rat Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Kinase C Zeta (PKCz) ELISA Kit
MBS453830-02 96 Tests

Rat Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Kinase C Zeta (PKCz) ELISA Kit
MBS453830-03 5x 96 Tests

Rat Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
Rat Protein Kinase C Zeta (PKCz) ELISA Kit
MBS453830-04 10x 96 Tests

Rat Protein Kinase C Zeta (PKCz) ELISA Kit

Sign In for Pricing
View Details
Dimetridazole-d3
TRC-D479662-5MG 5 mg

Dimetridazole-d3

Sign In for Pricing
View Details
Parg Mouse Gene Knockout Kit (CRISPR)
KN512813 1 Kit

Parg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details