Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF9 Peptide - middle region

C1QTNF9 Peptide - middle region

Product Specifications

Product Name Alternative

AQL1, CTRP9, C1QTNF9A

UniProt

P0C862

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QTNF9 Rabbit Polyclonal Antibody (orb589293) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001290066.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YFTYHITVFSRNVQVSLVKNGVKILHTKDAYMSSEDQASGGIVLQLKLGD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat IL-6 (Interleukin 6) ELISA Kit
EKE61991 96 Tests

Rat IL-6 (Interleukin 6) ELISA Kit

Sign In for Pricing
View Details
ANKZF1 Adenovirus (Rat)
12035056 1.0 mL

ANKZF1 Adenovirus (Rat)

Sign In for Pricing
View Details
NCRNA00051 sgRNA CRISPR Lentivector (Human) (Target 1)
K1401302 1.0 µg DNA

NCRNA00051 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Canine Protease Activated Receptor 4 ELISA Kit
MBS753600-01 48 Well

Canine Protease Activated Receptor 4 ELISA Kit

Sign In for Pricing
View Details
Canine Protease Activated Receptor 4 ELISA Kit
MBS753600-02 96 Well

Canine Protease Activated Receptor 4 ELISA Kit

Sign In for Pricing
View Details
Canine Protease Activated Receptor 4 ELISA Kit
MBS753600-03 5x 96 Well

Canine Protease Activated Receptor 4 ELISA Kit

Sign In for Pricing
View Details