KIR3DS1 Peptide - C-terminal region
KIR3DS1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
KIR-G1, NKAT10, CD158E2, NKAT-10, KIR-123FM
UniProt
Q14943
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIR3DS1 Rabbit Polyclonal Antibody (orb585786) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001077008
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GPKVQAGESVTLSCSSRSSYDMYHLSREGGAHERRLPAVRKVNRTFQADF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
#92510 1 Kit
Mix-n-StainTM CF®640R Nanobody Labeling Kit, 1x (5-20ug) labeling
Sign In for Pricing
View Details