Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HRH1 Peptide - C-terminal region

HRH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

H1R, H1-R, HH1R, hisH1

UniProt

P35367

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HRH1 Rabbit Polyclonal Antibody (orb586017) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000852

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSWPSPTEPSSKSGNLRHLHILIGTSVVKIPFTILLFFLLHRWCSNKKKC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD51 (Integrin alpha-V, Vitronectin Receptor Subunit alpha, Integrin alpha-V Heavy Chain, Integrin alpha-V Light Chain, ITGAV, MSK8, VNRA) (PE)
MBS6373135-01 0.1 mL

CD51 (Integrin alpha-V, Vitronectin Receptor Subunit alpha, Integrin alpha-V Heavy Chain, Integrin alpha-V Light Chain, ITGAV, MSK8, VNRA) (PE)

Sign In for Pricing
View Details
CD51 (Integrin alpha-V, Vitronectin Receptor Subunit alpha, Integrin alpha-V Heavy Chain, Integrin alpha-V Light Chain, ITGAV, MSK8, VNRA) (PE)
MBS6373135-02 5x 0.1 mL

CD51 (Integrin alpha-V, Vitronectin Receptor Subunit alpha, Integrin alpha-V Heavy Chain, Integrin alpha-V Light Chain, ITGAV, MSK8, VNRA) (PE)

Sign In for Pricing
View Details
FGFR3 alpha (IIIb) [Biotin], His, Mouse
Z04657-500 500 µg

FGFR3 alpha (IIIb) [Biotin], His, Mouse

Sign In for Pricing
View Details
Spidr (NM_001100988) Rat Untagged Clone
RN206720 10 µg

Spidr (NM_001100988) Rat Untagged Clone

Sign In for Pricing
View Details
6-Methyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2-carbaldehyde
TDC76435-01 50 mg

6-Methyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2-carbaldehyde

Sign In for Pricing
View Details
6-Methyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2-carbaldehyde
TDC76435-02 0.5 g

6-Methyl-4,5,6,7-tetrahydro-1,3-benzothiazole-2-carbaldehyde

Sign In for Pricing
View Details