Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX2 Peptide - C-terminal region

APEX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APE2, XTH2, ZGRF2, APEXL2

UniProt

Q9UBZ4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APEX2 Rabbit Polyclonal Antibody (orb586188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055296

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCG

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PCDHGC4
orb1133019 100 µg

Anti-PCDHGC4

Sign In for Pricing
View Details
Rabbit Monoclonal TNF RII/TNFRSF1B Antibody (340) [Alexa Fluor 700]
NBP2-90436AF700 0.1 mL

Rabbit Monoclonal TNF RII/TNFRSF1B Antibody (340) [Alexa Fluor 700]

Sign In for Pricing
View Details
RNU6-69 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV746736 1.0 µg DNA

RNU6-69 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
PLA2G4A, Recombinant, Human (Cytosolic Phospholipase A2, cPLA2, Phospholipase A2 Group IVA, Phospholipase A2, Phosphatidylcholine 2-acylhydrolase, Lysophospholipase, PLA2G4, CPLA2)
P4074-03R 10 µg

PLA2G4A, Recombinant, Human (Cytosolic Phospholipase A2, cPLA2, Phospholipase A2 Group IVA, Phospholipase A2, Phosphatidylcholine 2-acylhydrolase, Lysophospholipase, PLA2G4, CPLA2)

Sign In for Pricing
View Details
GRK3 Rabbit Polyclonal Antibody (BF680)
orb2541452 100 µL

GRK3 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
ZNF174 (Zinc Finger Protein 174)
496219 100 µL

ZNF174 (Zinc Finger Protein 174)

Sign In for Pricing
View Details