Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APEX2 Peptide - C-terminal region

APEX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

APE2, XTH2, ZGRF2, APEXL2

UniProt

Q9UBZ4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APEX2 Rabbit Polyclonal Antibody (orb586188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_055296

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMTPKTPEEKAVAKVVKGQAKTSEAKDEKELRTSFWKSVLAGPLRTPLCG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)
MBS1436929-01 0.02 mg (E-Coli)

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)
MBS1436929-02 0.1 mg (E-Coli)

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)
MBS1436929-03 0.02 mg (Yeast)

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)
MBS1436929-04 0.1 mg (Yeast)

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)
MBS1436929-05 0.02 mg (Baculovirus)

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)

Sign In for Pricing
View Details
Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)
MBS1436929-06 1 mg (E-Coli)

Recombinant Synechococcus sp. Photosystem II 12 kDa extrinsic protein (psbU)

Sign In for Pricing
View Details