Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NELFB Peptide - N-terminal region

NELFB Peptide - N-terminal region

Product Specifications

Product Name Alternative

COBRA1, NELF-B

UniProt

Q8WX92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NELFB Rabbit Polyclonal Antibody (orb586212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAD10 Human Gene Knockout Kit (CRISPR)
KN418001 1 Kit

ACAD10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Adenosine
TRC-A291823-50MG 50 mg

L-Adenosine

Sign In for Pricing
View Details
CaMK2α/β/δ (Ab-305) Antibody
8B0005-AAT 50 µg

CaMK2α/β/δ (Ab-305) Antibody

Sign In for Pricing
View Details
PLEKHG4 (NM_001129727) Human Over-expression Lysate
LY427036 100 µg

PLEKHG4 (NM_001129727) Human Over-expression Lysate

Sign In for Pricing
View Details
OMD Polyclonal Antibody
E-AB-90387-01 60 µL

OMD Polyclonal Antibody

Sign In for Pricing
View Details
OMD Polyclonal Antibody
E-AB-90387-02 120 µL

OMD Polyclonal Antibody

Sign In for Pricing
View Details