Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NELFB Peptide - N-terminal region

NELFB Peptide - N-terminal region

Product Specifications

Product Name Alternative

COBRA1, NELF-B

UniProt

Q8WX92

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NELFB Rabbit Polyclonal Antibody (orb586212) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_056271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELRD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fostamatinib
TRC-F112360-5MG 5 mg

Fostamatinib

Sign In for Pricing
View Details
SFMBT2 (NM_001029880) Human Over-expression Lysate
LY422258 100 µg

SFMBT2 (NM_001029880) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), 0.2mg/mL
BNUB1746-100 1x 100 µL

Human Herpes Virus 8 (HHV8) (LN53), 0.2mg/mL

Sign In for Pricing
View Details
Clgn Mouse Gene Knockout Kit (CRISPR)
KN503457 1 Kit

Clgn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D6]
TA802767BM 100 µL

CD4 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D6]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Lung
CB508793 1 Block

Frozen Tissue Blocks, Lung

Sign In for Pricing
View Details