Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS1 Peptide - C-terminal region

BCAS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIBC1, NABC1

UniProt

O75363

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAS1 Rabbit Polyclonal Antibody (orb586246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003648

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CRABP2 Antibody-PE (3D707)
TMAY-01745P-01 25 Tests

Anti-CRABP2 Antibody-PE (3D707)

Sign In for Pricing
View Details
Anti-CRABP2 Antibody-PE (3D707)
TMAY-01745P-02 100 Tests

Anti-CRABP2 Antibody-PE (3D707)

Sign In for Pricing
View Details
Human Calf intestinal alkaline phosphatase ELISA Kit
MBS7253984-01 48 Well

Human Calf intestinal alkaline phosphatase ELISA Kit

Sign In for Pricing
View Details
Human Calf intestinal alkaline phosphatase ELISA Kit
MBS7253984-02 96 Well

Human Calf intestinal alkaline phosphatase ELISA Kit

Sign In for Pricing
View Details
Human Calf intestinal alkaline phosphatase ELISA Kit
MBS7253984-03 5x 96 Well

Human Calf intestinal alkaline phosphatase ELISA Kit

Sign In for Pricing
View Details
Human Calf intestinal alkaline phosphatase ELISA Kit
MBS7253984-04 10x 96 Well

Human Calf intestinal alkaline phosphatase ELISA Kit

Sign In for Pricing
View Details