Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCAS1 Peptide - C-terminal region

BCAS1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AIBC1, NABC1

UniProt

O75363

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BCAS1 Rabbit Polyclonal Antibody (orb586246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003648

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GAPQKGKEGSSKDKKSAAEMNKQKSNKQEAKEPAQCTEQATVDTNSLQNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC anti-human HLA A2,B7 (MHC Class I)
MBS9471540-01 25 Tests

FITC anti-human HLA A2,B7 (MHC Class I)

Sign In for Pricing
View Details
FITC anti-human HLA A2,B7 (MHC Class I)
MBS9471540-02 100 Tests

FITC anti-human HLA A2,B7 (MHC Class I)

Sign In for Pricing
View Details
FITC anti-human HLA A2,B7 (MHC Class I)
MBS9471540-03 5x 100 Tests

FITC anti-human HLA A2,B7 (MHC Class I)

Sign In for Pricing
View Details
ICAM5 Rabbit Polyclonal Antibody (Cy3)
orb989936 100 µL

ICAM5 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Pcl1 Antibody
orb854583 2 mg

Pcl1 Antibody

Sign In for Pricing
View Details
PPY, GST-Tag, Recombinant (PNP, Pancreatic Prohormone) discontinued
500908 200 µg

PPY, GST-Tag, Recombinant (PNP, Pancreatic Prohormone) discontinued

Sign In for Pricing
View Details