DUSP2 Peptide - C-terminal region
DUSP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PAC1, PAC-1
UniProt
Q05923
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUSP2 Rabbit Polyclonal Antibody (orb589306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004409.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVLC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2930112-01 20 µg
Recombinant Crucihimalaya wallichii Photosystem I assembly protein Ycf4 (ycf4)
Sign In for Pricing
View Details orb2930112-02 100 µg
Recombinant Crucihimalaya wallichii Photosystem I assembly protein Ycf4 (ycf4)
Sign In for Pricing
View Details 
GTR15238488 1 Vial
Lentiviral mouse Ncam1 shRNA (UAS) - Lentiviral mouse Ncam1 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
M2363 100 µg
MAP Kinase p44/42, phosphorylated (Thr202/Tyr204) (MAPK3/MAPK1, Mitogen-activated Protein Kinase 1, MAP Kinase 1, MAPK 1, ERT1, Extracellular Signal-regulated Kinase 2, ERK-2, MAP Kinase Isoform p42, p42-MAPK, Mitogen-activated Protein Kinase 2, MAP Kinase 2, MAPK 2, ERK2, PRKM1, PRKM2 / Mitogen-activated Protein Kinase 3, MAP Kinase 3, MAPK 3, ERT2, Extracellular Signal-regulated Kinase 1, ERK-1, Insulin-stimulated MAP2 Kinase, MAP Kinase Isoform p44, p44-MAPK, Microtubule-associated Protein 2 Kinase, p44-ERK1, ERK1, PRKM3)
Sign In for Pricing
View Details 