Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP2 Peptide - C-terminal region

DUSP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PAC1, PAC-1

UniProt

Q05923

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP2 Rabbit Polyclonal Antibody (orb589306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVLC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)
MBS1014865-01 0.02 mg (E-Coli)

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)
MBS1014865-02 0.02 mg (Yeast)

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)
MBS1014865-03 0.1 mg (E-Coli)

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)
MBS1014865-04 0.1 mg (Yeast)

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)
MBS1014865-05 0.02 mg (Baculovirus)

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)

Sign In for Pricing
View Details
Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)
MBS1014865-06 0.02 mg (Mammalian-Cell)

Recombinant Aspergillus clavatus Autophagy-related protein 18 (atg18)

Sign In for Pricing
View Details