DUSP2 Peptide - C-terminal region
DUSP2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PAC1, PAC-1
UniProt
Q05923
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DUSP2 Rabbit Polyclonal Antibody (orb589306) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_004409.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVLC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PB9473-iFluor647 100 µg
Anti-Aquaporin 1/AQP1 Antibody Picoband® (iFluor647 Conjugate)
Sign In for Pricing
View Details 
MBS1439058-01 0.02 mg (E-Coli)
Recombinant Human Adenylate cyclase type 10 (ADCY10) , partial
Sign In for Pricing
View Details MBS1439058-02 0.1 mg (E-Coli)
Recombinant Human Adenylate cyclase type 10 (ADCY10) , partial
Sign In for Pricing
View Details MBS1439058-03 0.02 mg (Yeast)
Recombinant Human Adenylate cyclase type 10 (ADCY10) , partial
Sign In for Pricing
View Details MBS1439058-04 0.1 mg (Yeast)
Recombinant Human Adenylate cyclase type 10 (ADCY10) , partial
Sign In for Pricing
View Details MBS1439058-05 0.02 mg (Baculovirus)
Recombinant Human Adenylate cyclase type 10 (ADCY10) , partial
Sign In for Pricing
View Details