RNF103 Peptide - middle region
RNF103 Peptide - middle region
Product Specifications
Product Name Alternative
KF1, KF-1, HKF-1, ZFP103, ZFP-103
UniProt
O00237
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RNF103 Rabbit Polyclonal Antibody (orb589311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001185880.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-MK0136 96 Tests
ELISA kit for Monkey VEGFR1/FLT1 (Vascular Endothelial Growth Factor Receptor 1)
Sign In for Pricing
View Details 