Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RNF103 Peptide - middle region

RNF103 Peptide - middle region

Product Specifications

Product Name Alternative

KF1, KF-1, HKF-1, ZFP103, ZFP-103

UniProt

O00237

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RNF103 Rabbit Polyclonal Antibody (orb589311) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001185880.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLIDYFEKKRRRNNNNDEVNANNLEWLSSLWDWYTSYLFHPIASFQNFPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Luteotropic Hormone (LH) ELISA Kit
MBS3800446-01 48 Well

Human Luteotropic Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
Human Luteotropic Hormone (LH) ELISA Kit
MBS3800446-02 96 Well

Human Luteotropic Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
Human Luteotropic Hormone (LH) ELISA Kit
MBS3800446-03 5x 96 Well

Human Luteotropic Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
Human Luteotropic Hormone (LH) ELISA Kit
MBS3800446-04 10x 96 Well

Human Luteotropic Hormone (LH) ELISA Kit

Sign In for Pricing
View Details
GATA2 Protein Vector (Human) (pPB-C-His)
PV017257 500 ng

GATA2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
NBR1 Polyclonal Antibody
orb617694-01 50 μL

NBR1 Polyclonal Antibody

Sign In for Pricing
View Details