SSTR3 Peptide - middle region
SSTR3 Peptide - middle region
Product Specifications
Product Name Alternative
SS3R, SS3-R, SS-3-R, SSR-28
UniProt
P32745
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SSTR3 Rabbit Polyclonal Antibody (orb589329) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001042.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VNVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVL
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-430981-LAC-2 200 µL
β-glucuronidase Lentiviral Activation Particles (m2)
Sign In for Pricing
View Details 
