BPI Peptide - middle region
BPI Peptide - middle region
Product Specifications
Product Name Alternative
RBPI, BPIFD1
UniProt
P17213
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BPI Rabbit Polyclonal Antibody (orb589331) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001716.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDR
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1650318-01 20 µg
Recombinant Staphylococcus aureus ATP-dependent Clp protease ATP-binding subunit ClpC (clpC), partial
Sign In for Pricing
View Details 
orb1650318-02 100 µg
Recombinant Staphylococcus aureus ATP-dependent Clp protease ATP-binding subunit ClpC (clpC), partial
Sign In for Pricing
View Details 
orb1650318-03 1 mg
Recombinant Staphylococcus aureus ATP-dependent Clp protease ATP-binding subunit ClpC (clpC), partial
Sign In for Pricing
View Details FA169776-01 500 mg
2-[Amino (2-oxo-2H-1-benzopyran-3-yl) methylene]propanedinitrile
Sign In for Pricing
View Details