BPI Peptide - middle region
BPI Peptide - middle region
Product Specifications
Product Name Alternative
RBPI, BPIFD1
UniProt
P17213
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BPI Rabbit Polyclonal Antibody (orb589331) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001716.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AGINYGLVAPPATTAETLDVQMKGEFYSENHHNPPPFAPPVMEFPAAHDR
More Discoveries
Explore Other Products
Browse additional items from our catalog
DMAB3901 1 g
DiagPoly™ Plain Fluorescent Polystyrene Particles, Green, 5 μm, Dry
Sign In for Pricing
View Details 
MBS6387513-01 0.1 mL
NR6A1 (Nuclear Receptor Subfamily 6 Group A Member 1, Germ Cell Nuclear Factor, GCNF, hGCNF, Retinoid Receptor-related Testis-specific Receptor, RTR, hRTR, GCNF) (AP)
Sign In for Pricing
View Details