FKBP7 Peptide - middle region
FKBP7 Peptide - middle region
Product Specifications
Product Name Alternative
FKBP23, PPIase
UniProt
Q9Y680
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FKBP7 Rabbit Polyclonal Antibody (orb589334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001128684.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E45O54530E1-100 100 µg
PfHPRT Protein, P. falciparum, Recombinant (His Tag)
Sign In for Pricing
View Details 143603-ML750 100 µL
Interleukin 12 (IL-12, Cytotoxic Lymphocyte Maturation Factor 1, CTL Maturation Factor, TcMF, CLMF p35, Natural Killer Cell Stimulatory Factor 1, NFSK1, p35, T cell Stimulating Factor, TSF) (MaxLight 750) discontinued
Sign In for Pricing
View Details 
LV677704 1.0 µg DNA
CAPNS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details