Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP7 Peptide - middle region

FKBP7 Peptide - middle region

Product Specifications

Product Name Alternative

FKBP23, PPIase

UniProt

Q9Y680

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FKBP7 Rabbit Polyclonal Antibody (orb589334) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001128684.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGD4 siRNA
abx901941-01 15 nmol

Human FGD4 siRNA

Sign In for Pricing
View Details
Human FGD4 siRNA
abx901941-02 30 nmol

Human FGD4 siRNA

Sign In for Pricing
View Details
GALNTL2 (GALNT15) (NM_054110) Human Tagged Lenti ORF Clone
RC203849L3 10 µg

GALNTL2 (GALNT15) (NM_054110) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Clostridium Tetani galK Protein (aa 1-392)
VAng-Lsx01621-1mgEcoli 1 mg (E. coli)

Recombinant Clostridium Tetani galK Protein (aa 1-392)

Sign In for Pricing
View Details
Mainboard cpl w. Software
2500600 1 Each

Mainboard cpl w. Software

Sign In for Pricing
View Details
INSM1 Antibody
47803 100 µL

INSM1 Antibody

Sign In for Pricing
View Details