Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAXDC2 Peptide - N-terminal region

FAXDC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C5orf4

UniProt

Q96IV6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAXDC2 Rabbit Polyclonal Antibody (orb589339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115761.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBC1 (Phospho-Thr454) Rabbit Polyclonal Antibody
BT-AP08993-01 20 µL

DBC1 (Phospho-Thr454) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DBC1 (Phospho-Thr454) Rabbit Polyclonal Antibody
BT-AP08993-02 50 µL

DBC1 (Phospho-Thr454) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DBC1 (Phospho-Thr454) Rabbit Polyclonal Antibody
BT-AP08993-03 100 µL

DBC1 (Phospho-Thr454) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
mmu-miR-133b-3p miRNA Antagomir
MNM01156 2x 5.0 nmol

mmu-miR-133b-3p miRNA Antagomir

Sign In for Pricing
View Details
Human COL13A1 (NM_080802) AAV Particle
RC213395A1V 250 µL

Human COL13A1 (NM_080802) AAV Particle

Sign In for Pricing
View Details
BRF1 AAV Vector (Human) (CMV)
13473101 1 µg

BRF1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details