Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FAXDC2 Peptide - N-terminal region

FAXDC2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C5orf4

UniProt

Q96IV6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FAXDC2 Rabbit Polyclonal Antibody (orb589339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115761.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HnRPD Antibody
E18-5419-2 100 µg -100 µL

HnRPD Antibody

Sign In for Pricing
View Details
IQ motif containing B1 (IQCB1) (NM_001023570) Human Tagged Lenti ORF Clone
RC211421L3 10 µg

IQ motif containing B1 (IQCB1) (NM_001023570) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Tubulin (TUBA1B) Mouse Monoclonal Antibody [Clone ID: LBI3G3]
AMM13880V 100 µL

Tubulin (TUBA1B) Mouse Monoclonal Antibody [Clone ID: LBI3G3]

Sign In for Pricing
View Details
Os05g0477200 protein Rabbit Polyclonal Antibody (PE-Cy5)
orb896465 100 µL

Os05g0477200 protein Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
2,2',4,4'-Tetramethoxy-1,1'-biphenyl
OR1055385-01 250 mg

2,2',4,4'-Tetramethoxy-1,1'-biphenyl

Sign In for Pricing
View Details
2,2',4,4'-Tetramethoxy-1,1'-biphenyl
OR1055385-02 1 g

2,2',4,4'-Tetramethoxy-1,1'-biphenyl

Sign In for Pricing
View Details