CDC14B Peptide - middle region
CDC14B Peptide - middle region
Product Specifications
Product Name Alternative
CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
UniProt
O60729
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDC14B Rabbit Polyclonal Antibody (orb589352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001070649.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWII
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx539435 96 Tests
Mouse Paraneoplastic antigen Ma2 homolog (PNMA2) ELISA Kit
Sign In for Pricing
View Details 
MBS452960-01 48 Tests
Rat Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit
Sign In for Pricing
View Details MBS452960-02 96 Tests
Rat Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit
Sign In for Pricing
View Details MBS452960-03 5x 96 Tests
Rat Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit
Sign In for Pricing
View Details MBS452960-04 10x 96 Tests
Rat Tumor Necrosis Factor Receptor Superfamily, Member 1A (TNFRSF1A) ELISA Kit
Sign In for Pricing
View Details UPR-H52H7-100ug 100 µg
Human uPAR / PLAUR (115-305) Protein, His Tag (MALS verified)
Sign In for Pricing
View Details