CDC14B Peptide - middle region
CDC14B Peptide - middle region
Product Specifications
Product Name Alternative
CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
UniProt
O60729
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CDC14B Rabbit Polyclonal Antibody (orb589352) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001070649.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWII
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C2795-50B 100 µg
CDNF (Cerebral Dopamine Neurotrophic Factor, ARMET-like Protein 1, Conserved Dopamine Neurotrophic Factor, ARMETL1)
Sign In for Pricing
View Details 
041602-Biotin 200 µL
SET2, NT (Histone-lysine N-methyltransferase SETD2, SET domain-containing protein 2, hSET2, Huntingtin-interacting protein HYPB, Huntingtin yeast partner B, Huntingtin-interacting protein 1, HIF-1, p231HBP, SETD2, HIF1, HYPB, KIAA1732' SET2) (Biotin) discontinued
Sign In for Pricing
View Details 
CVSOLN021 100 mL
Crystal Violet Indicator 0.2% (w/v) in Glacial Acetic A
Sign In for Pricing
View Details