DPH6 Peptide - middle region
DPH6 Peptide - middle region
Product Specifications
Product Name Alternative
ATPBD4
UniProt
Q7L8W6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DPH6 Rabbit Polyclonal Antibody (orb55796) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001135444.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GISVGAILSDYQRIRVENVCKRLNLQPLAYLWQRNQEDLLREMISSNIQA
More Discoveries
Explore Other Products
Browse additional items from our catalog
428962 2.5 mg
(4- (4- ((4- (Chlorodifluoromethoxy) phenyl) amino) phthalazin-1-yl) phenyl) (morpholino) methanone
Sign In for Pricing
View Details K4083505 3x 1.0 µg
Chst9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 