Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEST1 Peptide - middle region

BEST1 Peptide - middle region

Product Specifications

Product Name Alternative

ARB, BMD, BEST, RP50, VMD2, TU15B

UniProt

O76090

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEST1 Rabbit Polyclonal Antibody (orb589356) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001132915.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGEDDDDFETNWIV

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MCPIP1/ZC3H12A Antibody [mFluor Violet 500 SE]
NBP3-18333MFV500 0.1 mL

Rabbit Polyclonal MCPIP1/ZC3H12A Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
SMU1 (WD40 Repeat-containing Protein SMU1, Smu-1 Suppressor of Mec-8 and Unc-52 Protein Homolog, SMU-1) (FITC)
MBS6394512-01 0.1 mL

SMU1 (WD40 Repeat-containing Protein SMU1, Smu-1 Suppressor of Mec-8 and Unc-52 Protein Homolog, SMU-1) (FITC)

Sign In for Pricing
View Details
SMU1 (WD40 Repeat-containing Protein SMU1, Smu-1 Suppressor of Mec-8 and Unc-52 Protein Homolog, SMU-1) (FITC)
MBS6394512-02 5x 0.1 mL

SMU1 (WD40 Repeat-containing Protein SMU1, Smu-1 Suppressor of Mec-8 and Unc-52 Protein Homolog, SMU-1) (FITC)

Sign In for Pricing
View Details
A430033K04Rik Lentiviral Activation Particles (m)
sc-433964-LAC 200 µL

A430033K04Rik Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Claudin 15 Polyclonal Antibody, Cy5 Conjugated
bs-13753R-Cy5 100 µL

Claudin 15 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Monoclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)
TRV-0033981-01 20 µL

Monoclonal Antibody to Vascular Cell Adhesion Molecule 1 (VCAM1)

Sign In for Pricing
View Details