GRTP1 Peptide - middle region
GRTP1 Peptide - middle region
Product Specifications
Product Name Alternative
TBC1D6
UniProt
Q5TC63
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GRTP1 Rabbit Polyclonal Antibody (orb589357) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001273661.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFP
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC683635-100 1x 100 µL
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TRV-0014604-01 10 µg
Recombinant Glutamate Cysteine Ligase, Modifier Subunit (GCLM)
Sign In for Pricing
View Details 
TRV-0014604-02 50 µg
Recombinant Glutamate Cysteine Ligase, Modifier Subunit (GCLM)
Sign In for Pricing
View Details TRV-0014604-03 100 µg
Recombinant Glutamate Cysteine Ligase, Modifier Subunit (GCLM)
Sign In for Pricing
View Details TRV-0014604-04 200 µg
Recombinant Glutamate Cysteine Ligase, Modifier Subunit (GCLM)
Sign In for Pricing
View Details