GRTP1 Peptide - middle region
GRTP1 Peptide - middle region
Product Specifications
Product Name Alternative
TBC1D6
UniProt
Q5TC63
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GRTP1 Rabbit Polyclonal Antibody (orb589357) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001273661.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LEHRARVWMVLSGAQAQMDQNPGYYHQLLQGERNPRLEDAIRTDLNRTFP
More Discoveries
Explore Other Products
Browse additional items from our catalog
CST 97118S 100 µL
C-Maf (E2Q5D) Rabbit Monoclonal Antibody (Alexa Fluor® 647 Conjugate)
Sign In for Pricing
View Details 
MBS742336-03 5x 96 Well
Bovine Heme Oxygenase 1, Decycling ELISA Kit
Sign In for Pricing
View Details