Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFNA2 Peptide - middle region

IFNA2 Peptide - middle region

Product Specifications

Product Name Alternative

IFNA, INFA2, IFNA2B, IFN-alphaA

UniProt

P01563

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IFNA2 Rabbit Polyclonal Antibody (orb589437) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000596.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Maltotetraose Deuterated
454175 1 mg

Maltotetraose Deuterated

Sign In for Pricing
View Details
pENTR223-SLC30A4 vector Plasmid
PVT12129 2 µg

pENTR223-SLC30A4 vector Plasmid

Sign In for Pricing
View Details
CCS antibody
FNab01395 100 µg

CCS antibody

Sign In for Pricing
View Details
Rabbit Anti-MCM4 antibody
SL11298R-01 50 µL

Rabbit Anti-MCM4 antibody

Sign In for Pricing
View Details
Rabbit Anti-MCM4 antibody
SL11298R-02 100 µL

Rabbit Anti-MCM4 antibody

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Transient-receptor-potential-like protein (trpl), partial
MBS1056239-01 1 mg (E-Coli)

Recombinant Drosophila melanogaster Transient-receptor-potential-like protein (trpl), partial

Sign In for Pricing
View Details