SLAMF7 Peptide - middle region
SLAMF7 Peptide - middle region
Product Specifications
Product Name Alternative
19A, CS1, CD319, CRACC
UniProt
Q9NQ25
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLAMF7 Rabbit Polyclonal Antibody (orb589441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001269517.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15198333 1 Vial
Lentiviral mouse Ebag9 shRNA (UAS) - Lentiviral mouse Ebag9 shRNA (UAS, GFP) (100)
Sign In for Pricing
View Details MBS6323348-01 0.1 mL
MYL6, ID (MYL6, Myosin light polypeptide 6, 17kD myosin light chain, Myosin light chain 3, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6) (MaxLight 550)
Sign In for Pricing
View Details MBS6323348-02 5x 0.1 mL
MYL6, ID (MYL6, Myosin light polypeptide 6, 17kD myosin light chain, Myosin light chain 3, Myosin light chain alkali 3, Smooth muscle and nonmuscle myosin light chain alkali 6) (MaxLight 550)
Sign In for Pricing
View Details