SLAMF7 Peptide - middle region
SLAMF7 Peptide - middle region
Product Specifications
Product Name Alternative
19A, CS1, CD319, CRACC
UniProt
Q9NQ25
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SLAMF7 Rabbit Polyclonal Antibody (orb589441) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001269517.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15116465 1 Vial
Lentiviral human PDS5A shRNA (UAS) - Lentiviral human PDS5A shRNA (UAS) (25)
Sign In for Pricing
View Details 
LV644785 1.0 µg DNA
LOC683514 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details MBS1880561-01 100 Tests
PE-conjugated Anti-FCRL5 (cevostamab biosimilar without anti-CD3 portion) mAb
Sign In for Pricing
View Details