Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIPEP Peptide - middle region

MIPEP Peptide - middle region

Product Specifications

Product Name Alternative

MIP, HMIP

UniProt

Q99797

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MIPEP Rabbit Polyclonal Antibody (orb589442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_005923.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KLNPQNSEVMPWDPPYYSGVIRAERYNIEPSLYCPFFSLGACMEGLNILL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNAT1 (NM_000172) Human Recombinant Protein
TP761701 50 µg

GNAT1 (NM_000172) Human Recombinant Protein

Sign In for Pricing
View Details
KLHL21 siRNA (Human)
orb1861610-01 15 nmol

KLHL21 siRNA (Human)

Sign In for Pricing
View Details
KLHL21 siRNA (Human)
orb1861610-02 30 nmol

KLHL21 siRNA (Human)

Sign In for Pricing
View Details
RASA1 Mouse Monoclonal Antibody [Clone ID: OTI2H1]
TA505900S 30 µL

RASA1 Mouse Monoclonal Antibody [Clone ID: OTI2H1]

Sign In for Pricing
View Details
Ethyl ganoderenate D
TN8641-01 10 mg

Ethyl ganoderenate D

Sign In for Pricing
View Details
Ethyl ganoderenate D
TN8641-02 50 mg

Ethyl ganoderenate D

Sign In for Pricing
View Details