MIPEP Peptide - middle region
MIPEP Peptide - middle region
Product Specifications
Product Name Alternative
MIP, HMIP
UniProt
Q99797
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MIPEP Rabbit Polyclonal Antibody (orb589442) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_005923.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KLNPQNSEVMPWDPPYYSGVIRAERYNIEPSLYCPFFSLGACMEGLNILL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15230682 1 Vial
Lentiviral mouse Nectin2 shRNA (UAS) - Lentiviral mouse Nectin2 shRNA (UAS) (100)
Sign In for Pricing
View Details 
GTR10342330 96 Well
Bovine Complement C1q tumor necrosis factor related protein 5 (C1QTNF5) ELISA Kit
Sign In for Pricing
View Details 
32558-05161 5x 30 µg
Human BMP-2 AssayLite™ Antibody (APC Conjugate)
Sign In for Pricing
View Details GDPD1-2162R 50 µg
Recombinant Rat GDPD1 Protein, His (Fc)-Avi-tagged
Sign In for Pricing
View Details